PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0708s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 217aa    MW: 23992.6 Da    PI: 9.2568
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0708s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B339.69e-131573696
                         EEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                   B3 36 ltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                         ++l +e+g sW+v++    + g+y l +GW+ Fv +ng++ gD++ Fkl++  + e++v+v
  Kaladp0708s0001.1.p  1 MVLHTETGSSWSVNI--VANTGGYKLCGGWSAFVIDNGINKGDICEFKLMS--RLEMWVQV 57
                         57899**********..99999**************************986..67778876 PP

2B358.51.2e-18112201295
                          EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                   B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                          ++++ + +v   ++l +p +f++e++++  ++ +++l++e+g sW+v++    + g+y + +GW+ Fv++ng+k gD++ Fkl++r   +
  Kaladp0708s0001.1.p 112 LTKMQRYNVEYVRILNIPMHFVRENSLSYCTDEKMVLRTETGSSWSVNV--VANMGGYKMCGGWSAFVSDNGIKKGDVCEFKLMSR--LK 197
                          555545555555889**********888888889***************..99999**************************9874..44 PP

                          .EEE CS
                   B3  92 lvvk 95 
                          ++v 
  Kaladp0708s0001.1.p 198 MRVE 201
                          4555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.45E-12157IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.8E-12157IPR015300DNA-binding pseudobarrel domain
PfamPF023621.8E-10157IPR003340B3 DNA binding domain
CDDcd100171.07E-9157No hitNo description
PROSITE profilePS5086312.985161IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.4E-21106203IPR015300DNA-binding pseudobarrel domain
CDDcd100176.73E-18109200No hitNo description
SuperFamilySSF1019361.57E-19109203IPR015300DNA-binding pseudobarrel domain
PfamPF023621.6E-16111200IPR003340B3 DNA binding domain
PROSITE profilePS5086313.479111206IPR003340B3 DNA binding domain
SMARTSM010197.3E-12111206IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MVLHTETGSS WSVNIVANTG GYKLCGGWSA FVIDNGINKG DICEFKLMSR LEMWVQVTPD  60
PKVASRTSRN GPPSCLPRNA EVKLRTVKPE LEHVIQNALK AADASSIGPS FLTKMQRYNV  120
EYVRILNIPM HFVRENSLSY CTDEKMVLRT ETGSSWSVNV VANMGGYKMC GGWSAFVSDN  180
GIKKGDVCEF KLMSRLKMRV EVTPNSKSAG EESRKGS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.12e-17B3 family protein